Recombinant Human MORC family CW-type zinc finger protein 3 (MORC3), partial | CSB-EP622753HU

(No reviews yet) Write a Review
SKU:
CSB-EP622753HU
Availability:
3 - 7 Working Days
  • Recombinant Human MORC family CW-type zinc finger protein 3 (MORC3), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,702.00

Description

Recombinant Human MORC family CW-type zinc finger protein 3 (MORC3), partial | CSB-EP622753HU | Cusabio

Alternative Name(s): Nuclear matrix protein 21 Zinc finger CW-type coiled-coil domain protein 3

Gene Names: MORC3

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: MAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVINDHICLTFTDNGNGMTSDKLHKMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAIVFTKNGESMSVGLLSQTYLEVIKAEHVVVPIVAFNKHRQMINLAESKASLAAILEHSLFSTEQKLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEITGKKGYKKQERMDQIAPESDYSLRAYCSILYLKPRMQIILRGQKVKTQLVSKSLAYIERDVY

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-290aa

Sequence Info: Partial

MW: 48.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Nuclear factor which forms MORC3-NBs (nuclear bodies) via an ATP-dependent mechanism (PubMed:20501696). Sumoylated MORC3-NBs can also associate with PML-NBs (PubMed:20501696). Recruits TP53 and SP100 to PML-NBs, thus regulating TP53 activity (PubMed:17332504). Binds RNA in vitro (PubMed:11927593). May be required for influenza A transcription during viral infection (PubMed:26202233).

Reference: "Uncovering global SUMOylation signaling networks in a site-specific manner."Hendriks I.A., D'Souza R.C., Yang B., Verlaan-de Vries M., Mann M., Vertegaal A.C.Nat. Struct. Mol. Biol. 21:927-936(2014).

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Nuclear factor which forms MORC3-NBs (nuclear bodies) via an ATP-dependent mechanism

Involvement in disease:

Subcellular Location: Nucleus, nucleoplasm, Nucleus matrix, Nucleus, PML body

Protein Families:

Tissue Specificity: Expressed in heart, placenta, skeletal muscle, brain, pancreas, lung, liver, but not kidney.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q14149

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose